PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010526675.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MIKC_MADS
Protein Properties Length: 239aa    MW: 27146.6 Da    PI: 5.8246
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010526675.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.44.5e-29959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+i+n + rqvtfskRr g++KKAeELSvLCda+va+iifsstgkl+ey+s
  XP_010526675.1  9 KKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYCS 59
                    68***********************************************96 PP

2K-box50.58.9e-18921701997
           K-box  19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      ++++L ke+ +  + +R++ Ge+L+ L++++LqqLe++Le +l+++ +kK+e ++++i +lq+k  el eenk+Lr++
  XP_010526675.1  92 SDHSRLSKELAEKSHRLRQMRGEELQGLNIEDLQQLEKALEAGLNRVIEKKSEKIMNEIGDLQRKGMELMEENKRLRQQ 170
                     56788888888888999************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.375161IPR002100Transcription factor, MADS-box
CDDcd002651.62E-40277No hitNo description
PRINTSPR004041.1E-27323IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.28E-32384IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.95687181IPR002487Transcription factor, K-box
PfamPF014863.7E-1692170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MAREKIQIKK IDNATARQVT FSKRRRGLFK KAEELSVLCD ADVALIIFSS TGKLFEYCSS  60
SMKEMLERHN LQSKNLEKLN QPSLELQLVE NSDHSRLSKE LAEKSHRLRQ MRGEELQGLN  120
IEDLQQLEKA LEAGLNRVIE KKSEKIMNEI GDLQRKGMEL MEENKRLRQQ GMRLMEENER  180
LGQQVSNEYE RYGGAESKNV VYEEGHSSES VTNAGNSAGP PVDDESSDTS LKLGLPYGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D3e-19370269MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-19370269MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-19370269MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-19370269MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J3e-19369268Myocyte-specific enhancer factor 2A
3p57_I3e-19369268Myocyte-specific enhancer factor 2A
3p57_D3e-19369268Myocyte-specific enhancer factor 2A
3p57_C3e-19369268Myocyte-specific enhancer factor 2A
3p57_B3e-19369268Myocyte-specific enhancer factor 2A
3p57_A3e-19369268Myocyte-specific enhancer factor 2A
3kov_J3e-19369268Myocyte-specific enhancer factor 2A
3kov_I3e-19369268Myocyte-specific enhancer factor 2A
3kov_B3e-19369268Myocyte-specific enhancer factor 2A
3kov_A3e-19369268Myocyte-specific enhancer factor 2A
1tqe_S3e-19170170Myocyte-specific enhancer factor 2B
1tqe_R3e-19170170Myocyte-specific enhancer factor 2B
1tqe_Q3e-19170170Myocyte-specific enhancer factor 2B
1tqe_P3e-19170170Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010526675.11e-173PREDICTED: MADS-box protein SVP-like
SwissprotQ9FVC11e-146SVP_ARATH; MADS-box protein SVP
TrEMBLA0A023ZT591e-147A0A023ZT59_BRAJU; Short vegetative phase protein
STRINGBra038511.1-P1e-146(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-147MIKC_MADS family protein